Cell Culture Media, Supplements, and Reagents
Medchemexpress LLC Ruxolitinib (S enantiomer) | 941685-37-6 | MFCD13184797 | 99.9% | 306.37 | C17H18N6 | 10 MG
Ruxolitinib (S enantiomer) is the single S enantiomer of ruxolitinib, an orally active and potent Janus kinase (JAK) inhibitor used in preclinical research to probe JAK-dependent signaling and related disease models. It has demonstrated in vitro suppression of interferon-β-induced gene expression and in vivo activity in myeloproliferative neoplasm models.
- Orally active, potent JAK inhibitor.
- Suitable for in vitro and in vivo preclinical studies.
- Chemical formula C17H18N6, molecular weight 306.37.
- CAS number 941685-37-6.
- Reported purity 99.9%.
- Available as solid and solution formats, including 10 mg solid and 10 mM in DMSO.
Medchemexpress LLC Sotorasib | 2296729-00-3 | 100mg
Sotorasib (AMG-510) is a first-in-class, orally bioavailable, and selective KRAS G12C covalent inhibitor. Sotorasib irreversibly inhibits KRAS G12C by locking it in an inactive GDP-bound state. Sotorasib is the first KRAS G12C inhibitor in clinical development and leads to the regression of KRAS G12C tumors.
Sigma Aldrich Fine Chemicals Biosciences Gentamicin sulfate from Micromonospora purpurea >=590 mug/mg of gentamicin | 1405-41-0 | MFCD00270181 | 1G
Gentamicin sulfate from Micromonospora purpurea >=590 mug/mg of gentamicin | 1405-41-0 | MFCD00270181 | 1G
Sigma Aldrich Fine Chemicals Biosciences Gentamicin sulfate from Micromonospora purpurea >=590 mug/mg of gentamicin | 1405-41-0 | MFCD00270181 | 5G
Gentamicin sulfate from Micromonospora purpurea >=590 mug/mg of gentamicin | 1405-41-0 | MFCD00270181 | 5G
Sigma Aldrich Fine Chemicals Biosciences Gentamicin sulfate from Micromonospora purpurea >=590 mug/mg of gentamicin | 1405-41-0 | MFCD00270181 | 25G
Gentamicin sulfate from Micromonospora purpurea >=590 mug/mg of gentamicin | 1405-41-0 | MFCD00270181 | 25G
Sigma Aldrich Fine Chemicals Biosciences Ofloxacin United States Pharmacopeia (USP) Reference Standard | 82419-36-1 | MFCD00226105 | 200MG
Ofloxacin United States Pharmacopeia (USP) Reference Standard | Mol Wt: 361.37 | 82419-36-1 | MFCD00226105 | 200MG
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2 (trifluoroacetate salt) 0.5MG
ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2MOLECULAR FORMULA: C180H288N58O47MOLECULAR WEIGHT:4016.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: N. Horvichi et al., Science, 238, 1566 (1987); B.E. Kemp et al., Science, 238, 1568 (1987)
Medchemexpress LLC HY-12516 10mg Medchemexpress, Desogestrel CAS:54024-22-5 Purity:>98%
Medchemexpress, HY-12516 10mg Desogestrel CAS:54024-22-5 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Cosmo Bio Usa Inc COS banker Cell Freezing Medium, 120 mL, serum-free, animal product-free, chemically defined, contains 10% DMSO, -80 °C storage, long-term cell storage, iPS cell freezing
COS banker Cell Freezing Medium, 120 mL, serum-free, animal product-free, chemically defined, contains 10% DMSO, -80 °C storage, long-term cell storage, iPS cell freezing
STEMCELL Technologies DNase I Solution (1 mg/mL), Size: 10 mL
Deoxyribonuclease (DNase) I Solution (1 mg/mL) is useful to reduce or prevent the clumping of concentrated and/or cryopreserved cell suspensions following thawing. The activity range is ≥ 2000 units per mg of protein.
Sigma Aldrich Fine Chemicals Biosciences EX-CELL(R) CD Insect Cell Medium | 1000ML
EX-CELL(R) CD Insect Cell Medium | 1000ML